PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.004G085400.1
Common NameB456_004G085400, LOC105790774
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family ARF
Protein Properties Length: 676aa    MW: 75919.8 Da    PI: 8.2704
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.004G085400.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B367.91.4e-21130232199
                         EEEE-..-HHHHTT-EE--HHH.HTT........---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEE CS
                  B3   1 ffkvltpsdvlksgrlvlpkkfaeeh........ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFk 83 
                         f k+ltpsd  ++g +++pk++a++         +  +  +++l  +d++g  W +++ +r++++r +lt+GW+ Fv +++L +gD+++F 
  Gorai.004G085400.1 130 FSKKLTPSDIKTHGGFSIPKRHANDGclplldmsQ--EIPQQELLATDLHGHPWYFRHVFRGYPKRNLLTTGWSTFVTSKKLAAGDSFIFL 218
                         88*********************777*****9643..444569************************************************ PP

                         E-SSSEE..EEEEE-S CS
                  B3  84 ldgrsefelvvkvfrk 99 
                         +   +++e+ v+v+r+
  Gorai.004G085400.1 219 R--GENGEFGVGVRRS 232
                         4..3777779999985 PP

2Auxin_resp93.43.8e-31258340183
          Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                         a ha++t+s+F+v+Y+P+a +s+F+ +++++ ka++  ++ G+R +m++e+ +s e+r  Gt++g++dldp+rW+nSkWr++k
  Gorai.004G085400.1 258 AFHAFATRSIFNVYYRPWARSSQFITPLDQYIKAVQFDYCFGTRCRMRVEGGESGEQRSLGTIIGTEDLDPIRWQNSKWRCVK 340
                         6799*****************************************************************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.108.4E-32123234IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019363.27E-26124232IPR015300DNA-binding pseudobarrel domain
CDDcd100177.05E-18128231No hitNo description
SMARTSM010193.2E-13130233IPR003340B3 DNA binding domain
PfamPF023621.1E-18130231IPR003340B3 DNA binding domain
PROSITE profilePS5086312.421130233IPR003340B3 DNA binding domain
PfamPF065072.9E-27258340IPR010525Auxin response factor
PROSITE profilePS5174518.571576659IPR000270PB1 domain
SuperFamilySSF542771.37E-6578654No hitNo description
PfamPF023099.1E-6616663IPR033389AUX/IAA domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009734Biological Processauxin-activated signaling pathway
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 676 aa     Download sequence    Send to blast
MDGEGHGSKA KFPFHSTRGE NNDLYTKLWH ACAGPSVYVP RSGDKVLYFP QGHMEQVEAY  60
MSEDGTMEMP IYNLPWKILC RVLHVELKVE PDTDEIFAEI ILLPEAEQDE QRMEHRYYRA  120
SPRENYSRYF SKKLTPSDIK THGGFSIPKR HANDGCLPLL DMSQEIPQQE LLATDLHGHP  180
WYFRHVFRGY PKRNLLTTGW STFVTSKKLA AGDSFIFLRG ENGEFGVGVR RSMTKLLNSP  240
SPSIISAHSV RHGILASAFH AFATRSIFNV YYRPWARSSQ FITPLDQYIK AVQFDYCFGT  300
RCRMRVEGGE SGEQRSLGTI IGTEDLDPIR WQNSKWRCVK VKWDPAASSV LLPERVCPWS  360
IDLTEFTKKK KASTLHHQKR ARPNNASSPE FSNLLMDGML HGTAKNQSQS SSGVLQGQED  420
SDTCVNQSSV LQQSLPHLLP QDPGCASMQQ QMHKQLEIQI PTCDPFYQCS SNTAHFSGRK  480
VPGLCNGLST ISSNRVHDDA RATKNGTSLS RPNGSHRCMV FGVNLFNGSP ELPSPQVLTS  540
SEVQCSTPLT SQSSVSIASK GISSKQCNNC CSVGDRTCTK VLKYGTNLGR SVDLYRFNGY  600
KGLILELDHM FDFNGKLIDG SSGWHITYTN EDGDMMLIGD PYPWQKFQHE VRRMVIRPKE  660
EINRLNPSSP SSASY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldv_A1e-1182136216353Auxin response factor 1
4ldw_A1e-1182136216353Auxin response factor 1
4ldw_B1e-1182136216353Auxin response factor 1
4ldx_A1e-1182136216353Auxin response factor 1
4ldx_B1e-1182136216353Auxin response factor 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtAuxin response factors (ARFs) are transcriptional factors that binds specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs). {ECO:0000256|RuleBase:RU004561}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX5894771e-50JX589477.1 Gossypium hirsutum clone NBRI_GE24193 microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012473977.10.0PREDICTED: auxin response factor 24-like
TrEMBLA0A0D2RVN50.0A0A0D2RVN5_G
STRINGVIT_07s0104g01230.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM157971016
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G62000.31e-132auxin response factor 2
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]